Recombinant Human Pro-epidermal growth factor (EGF), partial Active
Catalog No : IGX-RP2001-1MG
224.11€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Pro-epidermal growth factor (EGF), partial Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2001-1MG | ||
| Supplier’s Catalog No | IGX-RP2001-1MG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli, 971-1023 Amino Acids | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 13.4 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Pro-Epidermal Growth Factor; EGF; Epidermal Growth Factor; Urogastrone | ||
| Grade | Highly Purified | ||
| Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR. Biological Activity: The ED50 as determined by the dose-dependent proliferation of murine BALB/c 3T3 cells is typically 0.1-0.5 ng/ml | ||
Product Details
© 2020 Imugex All Rights Reserved