Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial Active
Catalog No : IGX-RP2004-100UG
269.19€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2004-100UG | ||
| Supplier’s Catalog No | IGX-RP2004-100UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli, 78-216 Amino Acids | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 18.0 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Killer cell lectin-like receptor subfamily K member 1 (NK cell receptor D) (NKG2-D-activating NK receptor) (CD314) | ||
| Grade | Highly Purified | ||
| Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Sequence: FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV. Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1, the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml. | ||
Product Details
© 2020 Imugex All Rights Reserved