Recombinant Human Insulin-like growth factor I (IGF1), partial Active

Catalog No : IGX-RP2006-1MG
282.07€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Insulin-like growth factor I (IGF1), partial Active
Catalog No IGX-RP2006-1MG
Supplier’s Catalog No IGX-RP2006-1MG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli, 52-118 Amino Acids
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 17.1 KDa
Storage Store at -20℃/-80℃.
Other names Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1
Grade Highly Purified
Purity >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized from a 0.2 μm Filtered 20 mM NaAc-HAC, pH 4.5
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA. Biological Activity: The ED50 as determined in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells is typically 1-8 ng/mL