Recombinant Human Insulin-like Growth factor-1 (IGF1), partial Active (GMP)

Catalog No : IGX-RP2022-1MG
355.49€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Insulin-like Growth factor-1 (IGF1), partial Active (GMP)
Catalog No IGX-RP2022-1MG
Supplier’s Catalog No IGX-RP2022-1MG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli, 49-118 Amino Acids
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 15.4 KDa
Storage Store at -20℃/-80℃.
Other names Mechano growth factor,MGF,Somatomedin-C,GF-I
Grade Highly Purified
Purity >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.0.
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA. Biological Activity: Biologically Fully Active when compared to standard. The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg.