Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Recombinant Human Ephrin-A4 (EFNA4), partial Active
Catalog No			IGX-RP2027-1MG
Supplier’s Catalog No			IGX-RP2027-1MG
Supplier			ImuGeX
Source antigen			Recombinant, expressed in E.Coli, 26-171 Amino Acids
Reactivity			Rhesus macaque
Cross reactivity			Rhesus macaque
Applications			Functional studies, Bioassays or User optimised
Molecular weight			14.0 KDa

Storage			Store at -20℃/-80℃.
Other names			Ephrin-A4; EPH-Related Receptor Tyrosine Kinase Ligand 4; LERK-4; EFNA4; EPLG4; LERK4
Grade			Highly Purified
Purity			>98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form			Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Reactivity life			12 months, when stored accoring to instructions.
Note			For reserch purpose only, not for In Vivo use or as therapeutics.
Purity			>98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description			Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils. Sequence: LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG. Biological Activity: The ED50 as determined by its ability to bind Human EphA7 in functional ELISA is less than 10 ug/ml.