Recombinant Human Interferon alpha-2 (IFNA2) Active
Catalog No : IGX-RP2030-1MG
597.63€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Interferon alpha-2 (IFNA2) Active | ||
---|---|---|---|
Catalog No | IGX-RP2030-1MG | ||
Supplier’s Catalog No | IGX-RP2030-1MG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli, 24-188 Amino Acids | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 17.7 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Interferon Alpha-2; IFN-Alpha-2; Interferon Alpha-A; LeIF A; IFNA2 | ||
Grade | Highly Purified | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Produced by macrophages, IFN-alpha have antiviral activities. Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE. Biological Activity: The ED50 as determined by a viral resistance assay using VSV-WISH cells is less than 10 pg/mL. |
© 2020 Imugex All Rights Reserved