Recombinant Human Interferon alpha-2 (IFNA2) Active
Catalog No : IGX-RP2031-1MG
616.95€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Interferon alpha-2 (IFNA2) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2031-1MG | ||
| Supplier’s Catalog No | IGX-RP2031-1MG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli, 24-188 Amino Acids | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 17.2 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Interferon Alpha-2; IFN-Alpha-2; Interferon Alpha-A; LeIF A; IFNA2 | ||
| Grade | Highly Purified | ||
| Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Produced by macrophages, IFN-alpha have antiviral activities. Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE. Biological Activity: The ED50 as determined by a viral resistance assay using VSV-WISH cells is typically 10 pg/mL. | ||
Product Details
© 2020 Imugex All Rights Reserved