Recombinant Human Immunoglobulin heavy constant gamma 1 (IGHG1), partial Active
Catalog No : IGX-RP2039-1MG
712.26€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Immunoglobulin heavy constant gamma 1 (IGHG1), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2039-1MG | ||
Supplier’s Catalog No | IGX-RP2039-1MG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli, 104-330 Amino Acids | ||
Reactivity | Mouse | ||
Cross reactivity | Mouse | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 17.4 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | g gamma-1 chain C region;IGHG1 | ||
Grade | Highly Purified | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens Sequence: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK. Biological Activity: The ED50 as determined by its ability to bind Human FCGR3A in functional ELISA is less than 10 ug/ml. |
© 2020 Imugex All Rights Reserved