Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial Active
Catalog No : IGX-RP2058-1MG
904.18€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2058-1MG | ||
Supplier’s Catalog No | IGX-RP2058-1MG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli, 56-182 Amino Acids | ||
Reactivity | Mouse | ||
Cross reactivity | Mouse | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 17.5 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Tumor Necrosis Factor Receptor Superfamily Member 10B; Death Receptor 5; TNF-Related Apoptosis-Inducing Ligand Receptor 2; TRAIL Receptor 2; TRAIL-R2; CD262; TNFRSF10B; DR5; KILLER; TRAILR2; TRICK2; ZTNFR9 | ||
Grade | Highly Purified | ||
Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Receptor for the cytotoxic ligand TNFSF10/TRAIL Sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE. Biological Activity: The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L‑929 mouse fibroblast cells treated with TRAIL is typically 23 ng/mL. |
© 2020 Imugex All Rights Reserved