Recombinant Mouse Fibroblast growth factor 2 (FGF2) Active

Catalog No : IGX-RP2061-1MG
932.51€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Mouse Fibroblast growth factor 2 (FGF2) Active
Catalog No IGX-RP2061-1MG
Supplier’s Catalog No IGX-RP2061-1MG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli, 1-154A mino Acids
Reactivity Horse
Cross reactivity Horse
Applications Functional studies, Bioassays or User optimised
Molecular weight 17.3 KDa
Storage Store at -20℃/-80℃.
Other names Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; Fgf2; Fgf-2
Grade Highly Purified
Purity >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized from a 0.2 μm filtered 20 mM PB, 400 mM NaCl, pH 7.0
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis. Sequence: MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS. Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 2 ng/ml.