Recombinant Human Tumor necrosis factor receptor superfamily member 5 (CD40), partial Active
Catalog No : IGX-RP2065-1MG
932.51€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Tumor necrosis factor receptor superfamily member 5 (CD40), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2065-1MG | ||
Supplier’s Catalog No | IGX-RP2065-1MG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli, 21-193 Amino Acids | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 14.5 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Tumor Necrosis Factor Receptor Superfamily member 5; B-Cell Surface Antigen CD40; Bp50; CD40L Receptor; CDw40; CD40; TNFRSF5 | ||
Grade | Highly Purified | ||
Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion. Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR. Biological Activity: The ED50 as determined by its ability to bind Human TNFSF5 in functional ELISA is less than 100 ug/ml. |
© 2020 Imugex All Rights Reserved