Recombinant Human Beta-nerve growth factor (NGF), partial Active
Catalog No : IGX-RP2070-1MG
999.49€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Beta-nerve growth factor (NGF), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2070-1MG | ||
Supplier’s Catalog No | IGX-RP2070-1MG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli, 122-239 Amino Acids | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 36.8 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB | ||
Grade | Highly Purified | ||
Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.0 | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR. Biological Activity: The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is less than 2 ng/ml. |
© 2020 Imugex All Rights Reserved