Recombinant Human Interferon-gamma (IFNG), partial Active (GMP)
Catalog No : IGX-RP2075-1MG
1018.81€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Interferon-gamma (IFNG), partial Active (GMP) | ||
|---|---|---|---|
| Catalog No | IGX-RP2075-1MG | ||
| Supplier’s Catalog No | IGX-RP2075-1MG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli, 24-166 Amino Acids | ||
| Reactivity | Mouse | ||
| Cross reactivity | Mouse | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 14.1 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Immune interferon,IFN-gamma | ||
| Grade | Highly Purified | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 5.0, with 3 % Trehalose. | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. Sequence: M+QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ. Biological Activity: Biologically Fully Active when compared to standard. The ED50 as measured in anti-viral assays using human HeLa cells infected with encephalomyocarditis (EMC) virus is 0.15-0.80 ng/ml. | ||
Product Details
© 2020 Imugex All Rights Reserved