Recombinant Mouse Interleukin-15 receptor subunit alpha (IL-15R α), partial Active
Catalog No : IGX-RP2082-1MG
1094.80€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Mouse Interleukin-15 receptor subunit alpha (IL-15R α), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2082-1MG | ||
Supplier’s Catalog No | IGX-RP2082-1MG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli, 33-205 Amino Acids | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 8.1 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Interleukin-15 receptor subunit alpha;Il15ra;sIL-15 receptor subunit alpha | ||
Grade | Highly Purified | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Signal transduction involves SYK (By similarity). Sequence: GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK. Biological Activity: The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL‑2 mouse cytotoxic T cells is less than 10 ng/ml. |
© 2020 Imugex All Rights Reserved