Recombinant Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C), partial Active
Catalog No : IGX-RP2090-1MG
1142.46€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C), partial Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2090-1MG | ||
| Supplier’s Catalog No | IGX-RP2090-1MG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli, 26-221 Amino Acids | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 7.9 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Tumor Necrosis Factor Receptor Superfamily Member 10C; Antagonist Decoy Receptor for TRAIL/Apo-2L; Decoy TRAIL Receptor Without Death Domain; Decoy Receptor 1; DcR1; Lymphocyte Inhibitor of TRAIL; TNF-Related Apoptosis-Inducing Ligand Receptor 3; TRAIL Receptor 3; TRAIL-R3; TRAIL Receptor Without an Intracellular Domain; CD263; TNFRSF10C; DCR1; LIT; TRAILR3; TRID | ||
| Grade | Highly Purified | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand. Sequence: ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA. Biological Activity: The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L‑929 mouse fibroblast cells treated with TRAIL is less than 200 ng/ml. | ||
© 2020 Imugex All Rights Reserved