Recombinant Human Beta-nerve growth factor (NGF) Active

Catalog No : IGX-RP2146-1MG
1620.30€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Beta-nerve growth factor (NGF) Active
Catalog No IGX-RP2146-1MG
Supplier’s Catalog No IGX-RP2146-1MG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli, 122-241 Amino Acids
Reactivity Mouse
Cross reactivity Mouse
Applications Functional studies, Bioassays or User optimised
Molecular weight 8.5 KDa
Storage Store at -20℃/-80℃.
Other names Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB
Grade Highly Purified
Purity >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.0
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA. Biological Activity: The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is less than 2 ng/ml.