Recombinant Human Insulin-like growth factor II (IGF2) Active

Catalog No : IGX-RP2147-1MG
1620.30€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Insulin-like growth factor II (IGF2) Active
Catalog No IGX-RP2147-1MG
Supplier’s Catalog No IGX-RP2147-1MG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli, 25-91 Amino Acids
Reactivity Mouse
Cross reactivity Mouse
Applications Functional studies, Bioassays or User optimised
Molecular weight 11.6 KDa
Storage Store at -20℃/-80℃.
Other names Insulin-Like Growth Factor II; IGF-II; Somatomedin-A; IGF2; PP1446
Grade Highly Purified
Purity >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized from a 0.2 μm Filtered 5 mM HAC, PH 3.0
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation (By similarity). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable). Sequence: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE. Biological Activity: The ED50 as determined in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells is less than 20 ng/ml.