Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Recombinant Human Insulin-like growth factor II (IGF2) Active
Catalog No			IGX-RP2147-1MG
Supplier’s Catalog No			IGX-RP2147-1MG
Supplier			ImuGeX
Source antigen			Recombinant, expressed in E.Coli, 25-91 Amino Acids
Reactivity			Mouse
Cross reactivity			Mouse
Applications			Functional studies, Bioassays or User optimised
Molecular weight			11.6 KDa

Storage			Store at -20℃/-80℃.
Other names			Insulin-Like Growth Factor II; IGF-II; Somatomedin-A; IGF2; PP1446
Grade			Highly Purified
Purity			>95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form			Lyophilized from a 0.2 μm Filtered 5 mM HAC, PH 3.0
Reactivity life			12 months, when stored accoring to instructions.
Note			For reserch purpose only, not for In Vivo use or as therapeutics.
Purity			>95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description			The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation (By similarity). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable). Sequence: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE. Biological Activity: The ED50 as determined in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells is less than 20 ng/ml.