Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Recombinant Human Thioredoxin (TXN) Active
Catalog No			IGX-RP2153-1MG
Supplier’s Catalog No			IGX-RP2153-1MG
Supplier			ImuGeX
Source antigen			Recombinant, expressed in E.Coli, 1-105 Amino Acids
Reactivity			Mouse
Cross reactivity			Mouse
Applications			Functional studies, Bioassays or User optimised
Molecular weight			12.1 KDa

Storage			Store at -20℃/-80℃.
Other names			Thioredoxin; Trx; ATL-Derived Factor; ADF; Surface-Associated Sulphydryl Protein; SASP; TXN; TRDX; TRX; TRX1
Grade			Highly Purified
Purity			>97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form			Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Reactivity life			12 months, when stored accoring to instructions.
Note			For reserch purpose only, not for In Vivo use or as therapeutics.
Purity			>97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description			Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.; FUNCTION Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV. Biological Activity: Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 0.1 Abs/min/mg.