Recombinant Human Interleukin-6 (IL-6), partial Active
Catalog No : IGX-RP2170-1MG
1773.58€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Interleukin-6 (IL-6), partial Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2170-1MG | ||
| Supplier’s Catalog No | IGX-RP2170-1MG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli, 29-212 Amino Acids | ||
| Reactivity | Rat | ||
| Cross reactivity | Rat | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 7.9 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Interleukin-6; IL-6; B-Cell Stimulatory Factor 2; BSF-2; CTL Differentiation Factor; CDF; Hybridoma Growth Factor; Interferon Beta-2; IFN-Beta-2; IL6; IFNB2 | ||
| Grade | Highly Purified | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized from a 0.2 μm Filtered 20 mM HAc-NaAc, 150 mM NaCl, pH 5.0 | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation. Sequence: PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM. Biological Activity: The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is less than 1 ng/ml. | ||
Product Details
© 2020 Imugex All Rights Reserved