Recombinant Human Interleukin-17A (IL-17A) Active
Catalog No : IGX-RP2171-1MG
1773.58€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Interleukin-17A (IL-17A) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2171-1MG | ||
| Supplier’s Catalog No | IGX-RP2171-1MG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli, 24-155 Amino Acids | ||
| Reactivity | Rat | ||
| Cross reactivity | Rat | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 7.8 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17 | ||
| Grade | Highly Purified | ||
| Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4 | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Ligand for IL17RA and IL17RC Sequence: GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA. Biological Activity: The ED50 as determined by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells is less than 10 ng/ml. | ||
Product Details
© 2020 Imugex All Rights Reserved