Recombinant Human Interleukin-11 (IL11), partial Active

Catalog No : IGX-RP2174-1MG
1773.58€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Interleukin-11 (IL11), partial Active
Catalog No IGX-RP2174-1MG
Supplier’s Catalog No IGX-RP2174-1MG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli, 23-199 Amino Acids
Reactivity Rat
Cross reactivity Rat
Applications Functional studies, Bioassays or User optimised
Molecular weight 8.4 KDa
Storage Store at -20℃/-80℃.
Other names Interleukin-11; IL-11; Adipogenesis Inhibitory Factor; AGIF; Oprelvekin; IL11
Grade Highly Purified
Purity >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized from a 0.2 μm filtered 20 mM PB, 2% Glycine, pH 7.2
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production Sequence: GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL. Biological Activity: The ED50 as determined in a cell proliferation assay using murine 7TD1 cells is typically 0.2 ng/mL