Recombinant Human Parathyroid hormone (PTH) Active
Catalog No : IGX-RP2178-1MG
1773.58€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Parathyroid hormone (PTH) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2178-1MG | ||
| Supplier’s Catalog No | IGX-RP2178-1MG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli, 32-115 Amino Acids | ||
| Reactivity | Rat | ||
| Cross reactivity | Rat | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 13.1 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Parathyroid Hormone; PTH; Parathormone; Parathyrin | ||
| Grade | Highly Purified | ||
| Purity | >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized from a 0.2 μm Filtered 10 mM HAc-NaAc, 150 mM NaCl, 5% Mannitol, pH 4.0 | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ. Biological Activity: The ED50 as determined by its ability to induce cAMP accumulation in MC3T3‑E1 mouse preosteoblast cells is less than 0.1 ug/ml | ||
Product Details
© 2020 Imugex All Rights Reserved