Recombinant Human EPO-alpha/Fc Chimera protein (EPOFc) Active
Catalog No : IGX-RP2180-1MG
1777.44€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human EPO-alpha/Fc Chimera protein (EPOFc) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2180-1MG | ||
| Supplier’s Catalog No | IGX-RP2180-1MG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli, 28-193 Amino Acids | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 8.9 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Epoetin, | ||
| Grade | Highly Purified | ||
| Purity | >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized from a 0.2μm filtered sodium citrate buffer (1 liter of ddH2O containing 5.9 g of sodium citrate, 5.8 g of sodium chloride and 0.06 g of citric acid) | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3. Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR+IEGRMDEPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK . Tag info:C-terminal FC-tagged. Biological Activity: Biologically Fully Active when compared to standard. The ED50 determined by a cell proliferation assay using human megakaryoblastic leukemia cells is less than 2 ng/ml, corresponding to a specific activity of ＞ 5.0 × 105 IU/mg. | ||
Product Details
© 2020 Imugex All Rights Reserved