Recombinant Human Insulin-like growth factor I protein (IGF1) Active
Catalog No : IGX-RP2186-1MG
1883.06€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Insulin-like growth factor I protein (IGF1) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2186-1MG | ||
| Supplier’s Catalog No | IGX-RP2186-1MG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli, MFPAMPLSSLFVN+49–118 Amino Acids ( E51R) | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 25.8 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | IGF-I, MGF, Somatomedin-C | ||
| Grade | Highly Purified | ||
| Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation Sequence: MFPAMPLSSLFVN+GPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA. Biological Activity: Assay 1: Biologically Fully Active when compared to standard. Measured in a serum-free cell proliferation assay using human MCF-7 cells. The ED50 for this effect is 0.3-1.5 ng/ml, corresponding to a specific activity of > 6.7 × 105 IU/mg. Assay 2: Biologically Fully Active when compared to standard. The ED50 as determined by the stimulation of protein synthesis using rat L6 myoblasts is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 105 IU/mg. | ||
Product Details
© 2020 Imugex All Rights Reserved