Recombinant Human Interferon gamma (IFNG) Active

Catalog No : IGX-RP2026-500G
391.55€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Interferon gamma (IFNG) Active
Catalog No IGX-RP2026-500G
Supplier’s Catalog No IGX-RP2026-500G
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 17.7 KDa
Storage Store at -20℃/-80℃.
Other names Interferon Gamma; IFN-Gamma; Immune Interferon; IFNG
Grade Highly Purified
Purity >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ