Recombinant Mouse Interleukin-15 receptor subunit alpha (IL-15R α), partial Active
Catalog No : IGX-RP2082-500UG
712.26€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Mouse Interleukin-15 receptor subunit alpha (IL-15R α), partial Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2082-500UG | ||
| Supplier’s Catalog No | IGX-RP2082-500UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 8.1 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Interleukin-15 receptor subunit alpha;Il15ra;sIL-15 receptor subunit alpha | ||
| Grade | Highly Purified | ||
| Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Signal transduction involves SYK (By similarity). Sequence: GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK | ||
© 2020 Imugex All Rights Reserved