Recombinant Mouse Tumor necrosis factor receptor superfamily member 14 (Tnfrsf14), partial Active
Catalog No : IGX-RP2085-500UG
712.26€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Mouse Tumor necrosis factor receptor superfamily member 14 (Tnfrsf14), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2085-500UG | ||
Supplier’s Catalog No | IGX-RP2085-500UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 7.9 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Tnfrsf14; Herpesvirus entry mediator;HVEM; TR2;TNF receptor-like molecule;ATAR;another TRAF-associated receptor;Tumor necrosis factor receptor superfamily member 14 | ||
Grade | Highly Purified | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Sequence: QPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQV |
© 2020 Imugex All Rights Reserved