Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) Active

Catalog No : IGX-RP2139-100UG
399.28€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Escherichia coli Iron-sulfur cluster repair protein ytfE (ytfE) Active
Catalog No IGX-RP2139-100UG
Supplier’s Catalog No IGX-RP2139-100UG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli
Reactivity Mouse
Cross reactivity Mouse
Applications Functional studies, Bioassays or User optimised
Molecular weight 9.9 KDa
Storage Store at -20℃/-80℃.
Other names Regulator of cell morphogenesis and NO signaling
Grade Highly Purified
Purity >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Sequence: MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE