Recombinant Human SIN3-HDAC complex-associated factor (SINHCAF) Active
Catalog No : IGX-RP2163-100UG
559.64€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human SIN3-HDAC complex-associated factor (SINHCAF) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2163-100UG | ||
| Supplier’s Catalog No | IGX-RP2163-100UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli | ||
| Reactivity | Rat | ||
| Cross reactivity | Rat | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 6.8 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Protein FAM60A (Tera protein homolog) (C12orf14) (FAM60A) | ||
| Grade | Highly Purified | ||
| Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Sequence: MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW | ||
Product Details
© 2020 Imugex All Rights Reserved