Recombinant Human Granulocyte colony-stimulating factor (CSF3), partial Active
Catalog No : IGX-RP2167-500UG
1267.39€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Granulocyte colony-stimulating factor (CSF3), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2167-500UG | ||
Supplier’s Catalog No | IGX-RP2167-500UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Rat | ||
Cross reactivity | Rat | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 9.4 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Granulocyte Colony-Stimulating Factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim; CSF3; C17orf33; GCSF | ||
Grade | Highly Purified | ||
Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Sequence: TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
© 2020 Imugex All Rights Reserved