Recombinant Human Interleukin-11 (IL11), partial Active
Catalog No : IGX-RP2174-500UG
1267.39€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Interleukin-11 (IL11), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2174-500UG | ||
Supplier’s Catalog No | IGX-RP2174-500UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Rat | ||
Cross reactivity | Rat | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 8.4 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Interleukin-11; IL-11; Adipogenesis Inhibitory Factor; AGIF; Oprelvekin; IL11 | ||
Grade | Highly Purified | ||
Purity | >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production Sequence: GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
© 2020 Imugex All Rights Reserved