Recombinant Human Interleukin-8 (CXCL8), partial Active

Catalog No : IGX-RP2175-500UG
1267.39€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Interleukin-8 (CXCL8), partial Active
Catalog No IGX-RP2175-500UG
Supplier’s Catalog No IGX-RP2175-500UG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli
Reactivity Rat
Cross reactivity Rat
Applications Functional studies, Bioassays or User optimised
Molecular weight 8.1 KDa
Storage Store at -20℃/-80℃.
Other names Interleukin-8; IL-8; C-X-C Motif Chemokine 8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived Neutrophil Chemotactic Factor; MDNCF; Monocyte-Derived Neutrophil-Activating Peptide; MONAP; Neutrophil-Activating Protein 1; NAP-1; Protein 3-10C; T-Cell Chemotactic Factor; IL8; CXCL8
Grade Highly Purified
Purity >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS