Recombinant Human Fibroblast growth factor 4 (FGF4), partial Active

Catalog No : IGX-RP2182-500UG
1295.73€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Fibroblast growth factor 4 (FGF4), partial Active
Catalog No IGX-RP2182-500UG
Supplier’s Catalog No IGX-RP2182-500UG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 9.1 KDa
Storage Store at -20℃/-80℃.
Other names Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HST; HSTF1; KS3
Grade Highly Purified
Purity >95% determined by SDS­PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >95% determined by SDS­PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis. Sequence: SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL