Recombinant Human Fibroblast growth factor 17 (FGF17) Active
Catalog No : IGX-RP2213-500UG
1563.63€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Fibroblast growth factor 17 (FGF17) Active | ||
---|---|---|---|
Catalog No | IGX-RP2213-500UG | ||
Supplier’s Catalog No | IGX-RP2213-500UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 28.1 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Fibroblast Growth Factor 17; FGF-17; FGF17 | ||
Grade | Highly Purified | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development. Sequence: TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT |
© 2020 Imugex All Rights Reserved