Recombinant Human Fibroblast growth factor 17 (FGF17) Active

Catalog No : IGX-RP2216-500UG
1563.63€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Fibroblast growth factor 17 (FGF17) Active
Catalog No IGX-RP2216-500UG
Supplier’s Catalog No IGX-RP2216-500UG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 7.0 KDa
Storage Store at -20℃/-80℃.
Other names Fibroblast Growth Factor 17; FGF-17; FGF17
Grade Highly Purified
Purity >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development. Sequence: TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT