Recombinant Human Fibroblast growth factor 8 (FGF8), partial Active
Catalog No : IGX-RP2221-500UG
1563.63€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Fibroblast growth factor 8 (FGF8), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2221-500UG | ||
Supplier’s Catalog No | IGX-RP2221-500UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 19.4 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Fibroblast growth factor 8;Androgen-induced growth factor;Heparin-binding growth factor 8;AIGF;HBGF-8;FGF-8B | ||
Grade | Highly Purified | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Sequence: QEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR |
© 2020 Imugex All Rights Reserved