Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			Recombinant Human Leukocyte surface antigen CD47 (CD47), partial Active
Catalog No			IGX-RP2261-500UG
Supplier’s Catalog No			IGX-RP2261-500UG
Supplier			ImuGeX
Source antigen			Recombinant, expressed in E.Coli
Reactivity			Human
Cross reactivity			Human
Applications			Functional studies, Bioassays or User optimised
Molecular weight			9.4 KDa

Storage			Store at -20℃/-80℃.
Other names			Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6
Grade			Highly Purified
Purity			>97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form			Lyophilized
Reactivity life			12 months, when stored accoring to instructions.
Note			For reserch purpose only, not for In Vivo use or as therapeutics.
Purity			>97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description			Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP