Recombinant Human Vesicle-associated membrane protein-associated protein B/C (VAPB), partial Active

Catalog No : IGX-RP2279-500UG
1563.63€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Vesicle-associated membrane protein-associated protein B/C (VAPB), partial Active
Catalog No IGX-RP2279-500UG
Supplier’s Catalog No IGX-RP2279-500UG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 13.9 KDa
Storage Store at -20℃/-80℃.
Other names Vesicle-associated membrane protein-associated protein B/C;VAMP-B/VAMP-C;VAMP-associated protein B/C;VAP-B/VAP-C
Grade Highly Purified
Purity >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation. Sequence: AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKP