Recombinant Mouse Transforming growth factor beta-1 (Tgfb1) Active

Catalog No : IGX-RP2440-500UG
1697.58€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Mouse Transforming growth factor beta-1 (Tgfb1) Active
Catalog No IGX-RP2440-500UG
Supplier’s Catalog No IGX-RP2440-500UG
Supplier ImuGeX
Source antigen Recombinant, expressed in Mammalian cell
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 15.1KDa & 16.0 KDa
Storage Store at -20℃/-80℃.
Other names TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP;latency-associated peptide; TGFbeta; TGF-beta 1 protein; transforming growth factor beta-1
Grade Highly Purified
Purity >90% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >90% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS