Recombinant Mouse Interleukin-7 (Il7) Active

Catalog No : IGX-RP2453-500UG
1563.63€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Mouse Interleukin-7 (Il7) Active
Catalog No IGX-RP2453-500UG
Supplier’s Catalog No IGX-RP2453-500UG
Supplier ImuGeX
Source antigen Recombinant, expressed in Mammalian cell
Reactivity Mouse
Cross reactivity Mouse
Applications Functional studies, Bioassays or User optimised
Molecular weight 14.6 KDa
Storage Store at -20℃/-80℃.
Other names IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoietin -1; PBGF
Grade Highly Purified
Purity >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. Sequence: ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI