Recombinant Human Interleukin-3 (IL3), partial Active (GMP)
Catalog No : IGX-RP2507-100UG
880.99€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Interleukin-3 (IL3), partial Active (GMP) | ||
---|---|---|---|
Catalog No | IGX-RP2507-100UG | ||
Supplier’s Catalog No | IGX-RP2507-100UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in Mammalian cell | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 36.9 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Hematopoietic growth factor,Mast cell growth factor,MCGF,Multipotential colony-stimulating factor,P-cell-stimulating factor,IL-3 | ||
Grade | Highly Purified | ||
Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Liquid | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION Sequence: APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
© 2020 Imugex All Rights Reserved