Recombinant Human Interleukin-6 (IL6), partial Active (GMP)
Catalog No : IGX-RP2508-100UG
880.99€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Interleukin-6 (IL6), partial Active (GMP) | ||
---|---|---|---|
Catalog No | IGX-RP2508-100UG | ||
Supplier’s Catalog No | IGX-RP2508-100UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 29.93 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | B-cell stimulatory factor 2,BSF-2,CTL differentiation factor,CDF,Hybridoma growth factor,Interferon beta-2,FN-beta-2,IL-6 | ||
Grade | Highly Purified | ||
Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Liquid | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation. Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
© 2020 Imugex All Rights Reserved