Recombinant Mouse Interleukin-13 (Il13) Active

Catalog No : IGX-RP2538-500UG
2132.93€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Mouse Interleukin-13 (Il13) Active
Catalog No IGX-RP2538-500UG
Supplier’s Catalog No IGX-RP2538-500UG
Supplier ImuGeX
Source antigen Recombinant, expressed in Mammalian cell
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 85.6 KDa
Storage Store at -20℃/-80℃.
Other names Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13
Grade Highly Purified
Purity >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses (By similarity). Positively regulates IL31RA expression in macrophages Sequence: PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF