Recombinant Human Platelet-derived Growth Factor-BB (PDGFB), partial Active (GMP)

Catalog No : IGX-RP2553-100UG
1119.27€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Recombinant Human Platelet-derived Growth Factor-BB (PDGFB), partial Active (GMP)
Catalog No IGX-RP2553-100UG
Supplier’s Catalog No IGX-RP2553-100UG
Supplier ImuGeX
Source antigen Recombinant, expressed in E.Coli
Reactivity Human
Cross reactivity Human
Applications Functional studies, Bioassays or User optimised
Molecular weight 15 KDa
Storage Store at -20℃/-80℃.
Other names PDGF subunit B PDGF-2 Platelet-derived growth factor B chain Platelet-derived growth factor beta polypeptide Proto-oncogene c-Sis INN: Becaplermin
Grade Highly Purified
Purity > 98 % by SDS-PAGE analyses > 95 % by HPLC analyses, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Form Lyophilized
Reactivity life 12 months, when stored accoring to instructions.
Note For reserch purpose only, not for In Vivo use or as therapeutics.
Purity > 98 % by SDS-PAGE analyses > 95 % by HPLC analyses, Endotoxin Level: <1.0 EU/µg as determined by LAL method.
Description Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin Sequence: M+SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPV