Recombinant Human Platelet-derived Growth Factor-BB (PDGFB), partial Active (GMP)
Catalog No : IGX-RP2553-100UG
1119.27€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Platelet-derived Growth Factor-BB (PDGFB), partial Active (GMP) | ||
---|---|---|---|
Catalog No | IGX-RP2553-100UG | ||
Supplier’s Catalog No | IGX-RP2553-100UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 15 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | PDGF subunit B PDGF-2 Platelet-derived growth factor B chain Platelet-derived growth factor beta polypeptide Proto-oncogene c-Sis INN: Becaplermin | ||
Grade | Highly Purified | ||
Purity | > 98 % by SDS-PAGE analyses > 95 % by HPLC analyses, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | > 98 % by SDS-PAGE analyses > 95 % by HPLC analyses, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin Sequence: M+SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPV |
© 2020 Imugex All Rights Reserved