Recombinant Human Fms-related Tyrosine Kinase 3 Ligand (FLT3LG), partial Active (GMP)
Catalog No : IGX-RP2554-100UG
750.90€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Fms-related Tyrosine Kinase 3 Ligand (FLT3LG), partial Active (GMP) | ||
---|---|---|---|
Catalog No | IGX-RP2554-100UG | ||
Supplier’s Catalog No | IGX-RP2554-100UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 20.8 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | SL cytokine,Flt3 ligand,Flt3L | ||
Grade | Highly Purified | ||
Purity | > 98 % by SDS-PAGE and HPLC analyses, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | > 98 % by SDS-PAGE and HPLC analyses, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. Sequence: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA |
© 2020 Imugex All Rights Reserved