Recombinant Human Interleukin-1 alpha (IL1A) Active (GMP)
Catalog No : IGX-RP2610-100UG
975.02€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Human Interleukin-1 alpha (IL1A) Active (GMP) | ||
---|---|---|---|
Catalog No | IGX-RP2610-100UG | ||
Supplier’s Catalog No | IGX-RP2610-100UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in Mammalian cell | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 53.4 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Hematopoietin-1,IL-1 alpha | ||
Grade | Highly Purified | ||
Purity | >93% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >93% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
© 2020 Imugex All Rights Reserved