Recombinant Mouse Pro-epidermal growth factor (Egf), partial Active
Catalog No : IGX-RP2008-500UG
224.11€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Mouse Pro-epidermal growth factor (Egf), partial Active | ||
---|---|---|---|
Catalog No | IGX-RP2008-500UG | ||
Supplier’s Catalog No | IGX-RP2008-500UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Human | ||
Cross reactivity | Human | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 15.0 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Pro-epidermal growth factor; Epidermal growth factor;EGF | ||
Grade | Highly Purified | ||
Purity | >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >96% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6 (By similarity). Sequence: NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR |
© 2020 Imugex All Rights Reserved