Recombinant Human Ephrin-A4 (EFNA4), partial Active
Catalog No : IGX-RP2027-50UG
179.03€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Ephrin-A4 (EFNA4), partial Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2027-50UG | ||
| Supplier’s Catalog No | IGX-RP2027-50UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli | ||
| Reactivity | Rhesus macaque | ||
| Cross reactivity | Rhesus macaque | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 14.0 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Ephrin-A4; EPH-Related Receptor Tyrosine Kinase Ligand 4; LERK-4; EFNA4; EPLG4; LERK4 | ||
| Grade | Highly Purified | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils. Sequence: LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG | ||
Product Details
© 2020 Imugex All Rights Reserved