Recombinant Mouse Fibroblast growth factor 1 (Fgf1) Active
Catalog No : IGX-RP2062-50UG
207.37€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Recombinant Mouse Fibroblast growth factor 1 (Fgf1) Active | ||
---|---|---|---|
Catalog No | IGX-RP2062-50UG | ||
Supplier’s Catalog No | IGX-RP2062-50UG | ||
Supplier | ImuGeX | ||
Source antigen | Recombinant, expressed in E.Coli | ||
Reactivity | Horse | ||
Cross reactivity | Horse | ||
Applications | Functional studies, Bioassays or User optimised | ||
Molecular weight | 17.4 KDa |
Storage | Store at -20℃/-80℃. | ||
---|---|---|---|
Other names | Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Heparin-Binding Growth Factor 1; HBGF-1; Fgf1; Fgf-1; Fgfa | ||
Grade | Highly Purified | ||
Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Form | Lyophilized | ||
Reactivity life | 12 months, when stored accoring to instructions. | ||
Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
Description | Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV Sequence: FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
© 2020 Imugex All Rights Reserved