Recombinant Mouse Interleukin-1 beta (Il1b) Active
Catalog No : IGX-RP2143-50UG
458.53€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Mouse Interleukin-1 beta (Il1b) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2143-50UG | ||
| Supplier’s Catalog No | IGX-RP2143-50UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli | ||
| Reactivity | Mouse | ||
| Cross reactivity | Mouse | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 7.9 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Interleukin-1 Beta; IL-1 Beta; Il1b | ||
| Grade | Highly Purified | ||
| Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >97% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS | ||
Product Details
© 2020 Imugex All Rights Reserved